HPA019832

NAPEPLD antibody from Sigma-Aldrich
C7orf18, FMP30, NAPE-PLD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019832
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019832, RRID:AB_1844422
Product name
Anti-NAPEPLD antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019832
Antibody type
Polyclonal
Antigen
N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALAN
EHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYL
NNDDE
Storage
-20C
Provider Type Product Number
- No reagents -