HPA005436

CC2D1A antibody from Atlas Antibodies
FLJ20241, Freud-1, MRT3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005436
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005436, RRID:AB_1078884
Product name
Anti-CC2D1A
Provider product page
Atlas Antibodies - HPA005436
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NLLASIRKGNAIDEADIPPPVAIGKGPASTPTYSP
APTQPAPRIASAPEPRVTLEGPSATAPASSPGLAK
PQMPPGPCSPGPLAQLQSRQRDYKLAALHAKQQGD
TTAAARHFRVAKSFDAVLE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -