HPA005436

CC2D1A antibody from Sigma-Aldrich
FLJ20241, MRT3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005436
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005436, RRID:AB_1078884
Product name
Anti-CC2D1A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005436
Antibody type
Polyclonal
Antigen
Coiled-coil and C2 domain-containing protein 1A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLLASIRKGNAIDEADIPPPVAIGKGPASTPTYSP
APTQPAPRIASAPEPRVTLEGPSATAPASSPGLAK
PQMPPGPCSPGPLAQLQSRQRDYKLAALHAKQQGD
TTAAARHFRVAKSFDAVLE
Storage
-20C
Provider Type Product Number
- No reagents -