HPA024141

NUP107 antibody from Sigma-Aldrich
NUP84
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024141
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024141, RRID:AB_1854710
Product name
Anti-NUP107 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024141
Antibody type
Polyclonal
Antigen
Nuclear pore complex protein Nup107 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HLLRFMTHLILFFRTLGLQTKEEVSIEVLKTYIQL
LIREKHTNLIAFYTCHLPQDLAVAQYALFLESVTE
FEQRHHCLELAKEADLDVATITKTVVENIRKKDNG
EFSHHDLAP
Storage
-20C
Provider Type Product Number
- No reagents -