HPA022864

KCNIP1 antibody from Sigma-Aldrich
KCHIP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022864
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022864, RRID:AB_1858712
Product name
Anti-KCNIP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022864
Antibody type
Polyclonal
Antigen
Kv channel-interacting protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPE
GLEQLEAQTNFTKRELQVLY
Storage
-20C
Provider Type Product Number
- No reagents -