Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004926-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004926-M01, RRID:AB_464007
- Product name
- NUMA1 monoclonal antibody (M01), clone 1C5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NUMA1.
- Antigen sequence
SPASPMGDILQTPQFQMRRLKKQLADERSNRDELE
LELAENRKLLTEKDAQIAMMQQRIDRLALLNEKQA
ASPLEPKELEELRDKNESLTMRLHETLKQCQDLKT
EK- Isotype
- IgG
- Antibody clone number
- 1C5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NUMA1 monoclonal antibody (M01), clone 1C5 Western Blot analysis of NUMA1 expression in K-562 ( Cat # L009V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged NUMA1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of NUMA1 transfected lysate using anti-NUMA1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NUMA1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol