HPA019859

NUMA1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019859
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019859, RRID:AB_1854709
Product name
Anti-NUMA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019859
Antibody type
Polyclonal
Antigen
Nuclear mitotic apparatus protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TEEGQQILKQPVSERLDFVCSFLQKNRKHPSSPEC
LVSAQKVLEGSELELAKMTMLLLYHSTMSSKSPRD
WEQFEYKIQAELAVILKFVLDHEDGLNLNEDLENF
LQKAPVPSTCSST
Storage
-20C
Provider Type Product Number
- No reagents -