Explore
Validate
LearnHPA005455
antibody from Atlas Antibodies
Targeting: NR5A2
B1F2, FTF, FTZ-F1, FTZ-F1beta, hB1F, hB1F-2, LRH-1, LRH1
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA005455 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA005455, RRID:AB_1078140
- Product name
- Anti-NR5A2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMS
QVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPP
TDYDRSPFVTSPISMTMPPHGSLQGYQTYGHFPSR
AIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIP
HLILELL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references LRH-1 drives hepatocellular carcinoma partially through induction of c-myc and cyclin E1, and suppression of p21
LRH-1 mitigates intestinal inflammatory disease by maintaining epithelial homeostasis and cell survival
Transcriptional regulation by NR5A2 links differentiation and inflammation in the pancreas
LRH-1 expression patterns in breast cancer tissues are associated with tumour aggressiveness
Tankyrase inhibition promotes a stable human naïve pluripotent state with improved functionality
Nuclear receptor liver receptor homologue 1 (LRH-1) regulates pancreatic cancer cell growth and proliferation
Xiao L, Wang Y, Liang W, Liu L, Pan N, Deng H, Li L, Zou C, Chan F, Zhou Y
Cancer Management and Research 2018;Volume 10
Cancer Management and Research 2018;Volume 10
LRH-1 mitigates intestinal inflammatory disease by maintaining epithelial homeostasis and cell survival
Bayrer J, Wang H, Nattiv R, Suzawa M, Escusa H, Fletterick R, Klein O, Moore D, Ingraham H
Nature Communications 2018;9(1)
Nature Communications 2018;9(1)
Transcriptional regulation by NR5A2 links differentiation and inflammation in the pancreas
Cobo I, Martinelli P, Flández M, Bakiri L, Zhang M, Carrillo-de-Santa-Pau E, Jia J, Sánchez-Arévalo Lobo V, Megías D, Felipe I, del Pozo N, Millán I, Thommesen L, Bruland T, Olson S, Smith J, Schoonjans K, Bamlet W, Petersen G, Malats N, Amundadottir L, Wagner E, Real F
Nature 2018;554(7693):533-537
Nature 2018;554(7693):533-537
LRH-1 expression patterns in breast cancer tissues are associated with tumour aggressiveness
Pang J, Molania R, Chand A, Knower K, Takano E, Byrne D, Mikeska T, Millar E, Lee C, O’Toole S, Clyne C, Gorringe K, Dobrovic A, Fox S
Oncotarget 2017;8(48):83626-83636
Oncotarget 2017;8(48):83626-83636
Tankyrase inhibition promotes a stable human naïve pluripotent state with improved functionality
Zimmerlin L, Park T, Huo J, Verma K, Pather S, Talbot C, Agarwal J, Steppan D, Zhang Y, Considine M, Guo H, Zhong X, Gutierrez C, Cope L, Canto-Soler M, Friedman A, Baylin S, Zambidis E
Development 2016;143(23):4368-4380
Development 2016;143(23):4368-4380
Nuclear receptor liver receptor homologue 1 (LRH-1) regulates pancreatic cancer cell growth and proliferation
Benod C, Vinogradova M, Jouravel N, Kim G, Fletterick R, Sablin E
Proceedings of the National Academy of Sciences 2011;108(41):16927-16931
Proceedings of the National Academy of Sciences 2011;108(41):16927-16931
No comments: Submit comment
No validations: Submit validation data