HPA005455

NR5A2 antibody from Sigma-Aldrich
B1F2, FTF, FTZ-F1, FTZ-F1beta, hB1F, hB1F-2, LRH-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005455
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005455, RRID:AB_1078140
Product name
Anti-NR5A2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005455
Antibody type
Polyclonal
Antigen
Orphan nuclear receptor NR5A2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMS
QVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPP
TDYDRSPFVTSPISMTMPPHGSLQGYQTYGHFPSR
AIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIP
HLILELL
Storage
-20C
Provider Type Product Number
- No reagents -