HPA017067

NR5A2 antibody from Sigma-Aldrich
B1F2, FTF, FTZ-F1, FTZ-F1beta, hB1F, hB1F-2, LRH-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017067
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017067, RRID:AB_1844767
Product name
Anti-NR5A2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017067
Antibody type
Polyclonal
Antigen
Nuclear receptor subfamily 5 group A member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNL
MSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVK
NLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFG
QLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNL
Storage
-20C
Provider Type Product Number
- No reagents -