HPA017067

NR5A2 antibody from Atlas Antibodies
B1F2, FTF, FTZ-F1, FTZ-F1beta, hB1F, hB1F-2, LRH-1, LRH1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017067
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017067, RRID:AB_1844767
Product name
Anti-NR5A2
Provider product page
Atlas Antibodies - HPA017067
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNL
MSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVK
NLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFG
QLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -