Antibody data

Product number
H00000822-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000822-M01A, RRID:AB_1204054
Product name
CAPG monoclonal antibody (M01A), clone 1F1
Provider product page
Abnova Corporation - H00000822-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant CAPG.
Antigen sequence
MYTAIPQSGSPFPGSVQDPGLHVWRVEKLKPVPVA
QENQGVFFSGDSYLVLHNGPEEVSHLHLWIGQQSS
RDEQGACAVLAVHLNTLLGERPVQHREVQGNESDL
FMSYFPRGLKYQEGGVESAFHKTSTGAPAAIKKLY
QVKGKKNIRATERALNWDSFNTGDCFILDLGQNIF
AWCGGKSNILERNKARDLALAIRDSERQGKAQVEI
VTDGEEPAEMIQVLGPKPALKEGNPEEDLTADKAN
AQAAALYKVSDATGQMNLTKVADSSPFALELLISD
DCFVLDNGLCGKIYIWKGRKANEKERQAALQVAEG
FISRMQYAPNTQVEILPQGRESPIFKQFFKDWK
Isotype
IgG
Antibody clone number
1F1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -