HPA019092

CAPG antibody from Sigma-Aldrich
AFCP, MCP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019092
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019092, RRID:AB_1845980
Product name
Anti-CAPG antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019092
Antibody type
Polyclonal
Antigen
Macrophage-capping protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ERNKARDLALAIRDSERQGKAQVEIVTDGEEPAEM
IQVLGPKPALKEGNPEEDLTADKANAQAAALYKVS
DATGQMNLTKVAD
Storage
-20C
Provider Type Product Number
- No reagents -