Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA019092 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA019092, RRID:AB_1845980
- Product name
- Anti-CAPG
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ERNKARDLALAIRDSERQGKAQVEIVTDGEEPAEM
IQVLGPKPALKEGNPEEDLTADKANAQAAALYKVS
DATGQMNLTKVAD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- 57e50c6745390
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Orthogonal validation by targeted mass spectrometry with stable isotope labeled antigen (QPrEST). Target protein was quantified across eight cell lines and the same cell lysate was subjected for WB-analysis.
- Sample type
- Cell lysates
- Validation comment
- Multiple western blot bands detected. One of expected molecular weight shows excellent correlation if compared to quantitative data determined by MS.
- Primary Ab dilution
- 0.2 ug/ml
- Other comments
- Multiple western blot bands detected. Band of expected molecular weight shows excellent correlation if compared to quantitative data determined by MS. This is thereby considered as validated for Western Blot applications, with additional cross-reactive band detected.
- Conjugate
- Horseradish Peroxidase
- Secondary Ab
- Secondary Ab
- Secondary Ab dilution
- 1:4000
- Protocol
- Protocol
- Number of samples
- 8
- p-value
- 0.001
- Correlation
- 0.97
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-CAPG antibody HPA019092 (A) shows similar pattern to independent antibody HPA019080 (B).
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human kidney, lung, lymph node and skeletal muscle using Anti-CAPG antibody HPA019092 (A) shows similar protein distribution across tissues to independent antibody HPA018843 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lung shows strong cytoplasmic and nuclear positivity in macrophages.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lung using Anti-CAPG antibody HPA019092.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node using Anti-CAPG antibody HPA019092.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle using Anti-CAPG antibody HPA019092.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney using Anti-CAPG antibody HPA019092.
- Sample type
- HUMAN