HPA019092

CAPG antibody from Atlas Antibodies
AFCP, MCP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019092
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019092, RRID:AB_1845980
Product name
Anti-CAPG
Provider product page
Atlas Antibodies - HPA019092
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ERNKARDLALAIRDSERQGKAQVEIVTDGEEPAEM
IQVLGPKPALKEGNPEEDLTADKANAQAAALYKVS
DATGQMNLTKVAD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -