HPA005456

ARID1A antibody from Atlas Antibodies
B120, BAF250, BAF250a, C10rf4, C1orf4, P270, SMARCF1
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA005456
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005456, RRID:AB_888209
Product name
Anti-ARID1A
Provider product page
Atlas Antibodies - HPA005456
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNM
STGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQR
HDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -