HPA005456

ARID1A antibody from Sigma-Aldrich
B120, BAF250, BAF250a, C10rf4, C1orf4, P270, SMARCF1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005456
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005456, RRID:AB_1078205
Product name
Anti-ARID1A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005456
Antibody type
Polyclonal
Antigen
AT-rich interactive domain-containing protein 1A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNM
STGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQR
HDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYK
Storage
-20C
Provider Type Product Number
- No reagents -