HPA005457

antibody from Atlas Antibodies

Targeting: SEC31A ABP125, ABP130, KIAA0905, SEC31L1

Antibody data

Submit

Validation data

Product number: HPA005457 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA005457, RRID:AB_1079896
Product name: Anti-SEC31A
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: NWREALAAVLTYAKPDEFSALCDLLGTRLENEGDS LLQTQACLCYICAGNVEKLVACWTKAQDGSHPLSL QDLIEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQ YANLLAAQGSIAAALAFLPDNTNQPNIMQLR
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SEC31A protein structure - HPA005457 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human endometrium and skeletal muscle tissues using HPA005457 antibody. Corresponding SEC31A RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic and nuclear(nucleolar) positivity in neuronal cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows positivit in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows positivity in neurons.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows positivity in hepatocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows very weak positivity in myocytes.
Sample type: HUMAN