HPA005457

SEC31A antibody from Sigma-Aldrich
ABP125, ABP130, KIAA0905, SEC31L1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005457
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005457, RRID:AB_1079896
Product name
Anti-SEC31A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005457
Antibody type
Polyclonal
Antigen
SEC31 homolog A isoform 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NWREALAAVLTYAKPDEFSALCDLLGTRLENEGDS
LLQTQACLCYICAGNVEKLVACWTKAQDGSHPLSL
QDLIEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQ
YANLLAAQGSIAAALAFLPDNTNQPNIMQLR
Storage
-20C
Provider Type Product Number
- No reagents -