H00004108-M03A

MAGEA9 antibody from Abnova Corporation
CT1.9, MAGE9, MGC8421

Antibody data

Product number
H00004108-M03A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004108-M03A, RRID:AB_1237771
Product name
MAGEA9 monoclonal antibody (M03A), clone 2C1
Provider product page
Abnova Corporation - H00004108-M03A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant MAGEA9.
Antigen sequence
MSLEQRSPHCKPDEDLEAQGEDLGLMGAQEPTGEE
EETTSSSDSKEEEVSAAGSSSPPQSPQGGASSSIS
VYYTLWSQFDEGSSSQEEEEPSSSVDPAQLEFMFQ
EALELKVAELVHFLLHKYRVKEPVTKAEMLESVIK
NYKRYFPVIFGKASEFMQVIFGTDVKEVDPAGHSY
ILVTALGLSCDSMLGDGHSMPKAALLIIVLGVILT
KDNCAPEEVIWEALSVMGVYVGKEHMFYGEPRKLL
TQDWVQENYLEYRQVPGSDPAHYEFLWGSKAHAET
SYEKVINYLVMLNAREPICYPSLYEEVLGEEQEGV
Isotype
IgM
Antibody clone number
2C1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -