HPA005684

SEC16A antibody from Atlas Antibodies
KIAA0310, p250, Sec16L
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005684
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005684, RRID:AB_1079189
Product name
Anti-SEC16A
Provider product page
Atlas Antibodies - HPA005684
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGL
ANPEPAPEPKAPGDLPAAGGPPSGAMPFYNPAQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -