HPA005684

SEC16A antibody from Sigma-Aldrich
KIAA0310, p250, Sec16L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005684
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005684, RRID:AB_1079189
Product name
Anti-SEC16A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005684
Antibody type
Polyclonal
Antigen
Protein transport protein Sec16A (Protein SEC16 homolog A)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGL
ANPEPAPEPKAPGDLPAAGGPPSGAMPFYNPAQ
Storage
-20C
Provider Type Product Number
- No reagents -