Antibody data

Product number
HPA019520
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019520, RRID:AB_1847400
Product name
Anti-PPID
Provider product page
Atlas Antibodies - HPA019520
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FITTVPTPHLDGKHVVFGQVIKGIGVARILENVEV
KGEKPAKLCVIAECGELKEGDDGGIFPKDGSGDSH
PDFPE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.