HPA019520

PPID antibody from Sigma-Aldrich
CYP-40
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019520
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019520, RRID:AB_1847400
Product name
Anti-PPID antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019520
Antibody type
Polyclonal
Antigen
40 kDa peptidyl-prolyl cis-trans isomerase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FITTVPTPHLDGKHVVFGQVIKGIGVARILENVEV
KGEKPAKLCVIAECGELKEGDDGGIFPKDGSGDSH
PDFPE
Storage
-20C
Provider Type Product Number
- No reagents -