HPA019692

PPID antibody from MilliporeSigma / Merck KGaA
CYP-40
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019692
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA019692, RRID:AB_1847401
Product name
Anti-PPID antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019692
Antibody type
Polyclonal
Antigen
40 kDa peptidyl-prolyl cis-trans isomerase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IDSCLEALELDPSNTKALYRRAQGWQGLKEYDQAL
ADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDKEK
AV
Storage
-20C
Provider Type Product Number
- No reagents -