ABIN487206
antibody from antibodies-online
Targeting: ATP6V0A1
a1, ATP6N1, ATP6N1A, Stv1, Vph1, VPP1
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN487206 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-ATPase, H+ Transporting, Lysosomal V0 Subunit A1 (ATP6V0A1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ATP6V0A1 antibody: synthetic peptide directed towards the N terminal of human ATP6V0A1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
RDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEI
RKANI PIMDTGENPE- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references POLR2F, ATP6V0A1 and PRNP expression in colorectal cancer: new molecules with prognostic significance?
The differential reactivity of cells of the melanocytic lineage with four monoclonal antibodies against IFN-gamma inducible molecules.
Antonacopoulou AG, Grivas PD, Skarlas L, Kalofonos M, Scopa CD, Kalofonos HP
Anticancer research 2008 Mar-Apr;28(2B):1221-7
Anticancer research 2008 Mar-Apr;28(2B):1221-7
The differential reactivity of cells of the melanocytic lineage with four monoclonal antibodies against IFN-gamma inducible molecules.
Vacca A, Frassanito A, Rimoldi D, Dammacco F, Carrel S
Anticancer research 1992 Jan-Feb;12(1):1-9
Anticancer research 1992 Jan-Feb;12(1):1-9
No comments: Submit comment
No validations: Submit validation data