Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310454 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Synovial Apoptosis Inhibitor 1, Synoviolin (SYVN1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SYVN1 antibody: synthetic peptide directed towards the middle region of human SYVN1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
QGLLPPFPPGMFPLWPPMGPFPPVPPPPSSGEAVA
PPSTS AALSRPSGAA- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references SEL1L and HRD1 are involved in the degradation of unassembled secretory Ig-mu chains.
Cattaneo M, Otsu M, Fagioli C, Martino S, Lotti LV, Sitia R, Biunno I
Journal of cellular physiology 2008 Jun;215(3):794-802
Journal of cellular physiology 2008 Jun;215(3):794-802
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting