HPA018284

GGCX antibody from MilliporeSigma / Merck KGaA
VKCFD1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018284
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA018284, RRID:AB_1849641
Product name
Anti-GGCX antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA018284
Antibody type
Polyclonal
Antigen
Vitamin K-dependent gamma-carboxylase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQK
NQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYV
NTTELALEQDLAYLQELKEKVENGSETGPLPPELQ
PLLEGEVK
Storage
-20C
Provider Type Product Number
- No reagents -