HPA003923

MAMLD1 antibody from Sigma-Aldrich
CG1, CXorf6, F18
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003923
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003923, RRID:AB_10602034
Product name
Anti-MAMLD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003923
Antibody type
Polyclonal
Antigen
mastermind-like domain containing 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KRPCLEDVTLAMGPGAHPSTACAELQVPPLTINPS
PAAMGVAGQSLLLENNPMNGNIMGSPFVVPQTTEV
GLKGPTVPYYEKINSVPAVDQELQELLEELTKIQD
PSPNELDLE
Storage
-20C
Provider Type Product Number
- No reagents -