HPA005438

HNF4G antibody from Atlas Antibodies
NR2A2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005438
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005438, RRID:AB_1234515
Product name
Anti-HNF4G
Provider product page
Atlas Antibodies - HPA005438
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
WQMIEQIQFVKLFGMVKIDNLLQEMLLGGASNDGS
HLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQIS
TPETPLPSPPQGSGQEQYKIAANQASVISHQHLSK
QKQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -