HPA005438

HNF4G antibody from Sigma-Aldrich
NR2A2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005438
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005438, RRID:AB_1850822
Product name
Anti-HNF4G antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005438
Antibody type
Polyclonal
Antigen
Hepatocyte nuclear factor 4-gamma recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WQMIEQIQFVKLFGMVKIDNLLQEMLLGGASNDGS
HLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQIS
TPETPLPSPPQGSGQEQYKIAANQASVISHQHLSK
QKQ
Storage
-20C
Provider Type Product Number
- No reagents -