HPA018795

FGF18 antibody from Sigma-Aldrich
FGF-18, ZFGF5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018795
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018795, RRID:AB_1848523
Product name
Anti-FGF18 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018795
Antibody type
Polyclonal
Antigen
Fibroblast growth factor 18 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTS
GKHIQVLGRRISARGED
Storage
-20C
Provider Type Product Number
- No reagents -