Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA018795 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-FGF18
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTS
GKHIQVLGRRISARGED- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Use of FGF-2 and FGF-18 to direct bone marrow stromal stem cells to chondrogenic and osteogenic lineages
Hedgehog inhibits β-catenin activity in synovial joint development and osteoarthritis
Stem cell quiescence acts as a tumour suppressor in squamous tumours
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Shu C, Smith S, Little C, Melrose J
Future Science OA 2016;2(4)
Future Science OA 2016;2(4)
Hedgehog inhibits β-catenin activity in synovial joint development and osteoarthritis
Rockel J, Yu C, Whetstone H, Craft A, Reilly K, Ma H, Tsushima H, Puviindran V, Al-Jazrawe M, Keller G, Alman B
Journal of Clinical Investigation 2016;126(5):1649-1663
Journal of Clinical Investigation 2016;126(5):1649-1663
Stem cell quiescence acts as a tumour suppressor in squamous tumours
White A, Khuu J, Dang C, Hu J, Tran K, Liu A, Gomez S, Zhang Z, Yi R, Scumpia P, Grigorian M, Lowry W
Nature Cell Biology 2013;16(1):99-107
Nature Cell Biology 2013;16(1):99-107
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Stadler C, Rexhepaj E, Singan V, Murphy R, Pepperkok R, Uhlén M, Simpson J, Lundberg E
Nature Methods 2013;10(4):315-323
Nature Methods 2013;10(4):315-323
No comments: Submit comment
No validations: Submit validation data