HPA027733

HIPK4 antibody from Sigma-Aldrich
FLJ32818
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027733
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027733, RRID:AB_1850734
Product name
Anti-HIPK4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027733
Antibody type
Polyclonal
Antigen
Homeodomain-interacting protein kinase 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SETDCYDIIEVLGKGTFGEVAKGWRRSTGEMVAIK
ILKNDAYRNRIIKNELKLLHCMRGLDPEEAHVIRF
LEFFHDALKFYLVFELLEQNLFEFQKENNFAPLPA
RHIRTVTLQVLTALARLKELAIIH
Storage
-20C
Provider Type Product Number
- No reagents -