Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182342 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-YEATS Domain Containing 4 (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-YEATS4 antibody: synthetic peptide directed towards the middle region of human YEATS4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
SRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSF
EIAEL KERLKASRET- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Targeted disruption of the GAS41 gene encoding a putative transcription factor indicates that GAS41 is essential for cell viability.
Zimmermann K, Ahrens K, Matthes S, Buerstedde JM, Strätling WH, Phi-van L
The Journal of biological chemistry 2002 May 24;277(21):18626-31
The Journal of biological chemistry 2002 May 24;277(21):18626-31
No comments: Submit comment
No validations: Submit validation data