Antibody data

Product number
H00004886-M21
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004886-M21, RRID:AB_1578149
Product name
NPY1R monoclonal antibody (M21), clone 3A1
Provider product page
Abnova Corporation - H00004886-M21
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant NPY1R.
Antigen sequence
MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHL
PLAMIFTLALAYGAVIILGVSGNLALIIIILKQKE
MRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDH
WVFGEAMCKLNPFVQCVPITVSIFSLVLIAVERHQ
LIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLI
YQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLS
YTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMM
DKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLT
IFNTVYDWNHQIIATCNHNLLFLLCHLTAMISTCV
NPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETI
AMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI
Isotype
IgG
Antibody clone number
3A1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -