HPA021032

HSD17B1 antibody from Atlas Antibodies
EDH17B2, EDHB17, HSD17, MGC138140, SDR28C1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021032
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021032, RRID:AB_1844345
Product name
Anti-HSD17B1
Provider product page
Atlas Antibodies - HPA021032
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIH
TFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALR
APKPTL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -