PAB21184

TMEM150A antibody from Abnova Corporation
FLJ90024, TM6P1, TMEM150, TTN1

Antibody data

Product number
PAB21184
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21184, RRID:AB_10984118
Product name
TMEM150 polyclonal antibody
Provider product page
Abnova Corporation - PAB21184
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant TMEM150.
Antigen sequence
VMNHHVCPVENWSYNESCPPDPAEQGGPKTCCTLD
DVPLISKCGSYP
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -