HPA019015

TMEM150A antibody from Sigma-Aldrich
FLJ90024, TM6P1, TMEM150
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019015
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019015, RRID:AB_2204758
Product name
Anti-TMEM150 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019015
Antibody type
Polyclonal
Antigen
Transmembrane protein 150 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VMNHHVCPVENWSYNESCPPDPAEQGGPKTCCTLD
DVPLISKCGSYP
Storage
-20C
Provider Type Product Number
- No reagents -