HPA019015

TMEM150A antibody from Atlas Antibodies
FLJ90024, TM6P1, TMEM150, TTN1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019015
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019015, RRID:AB_2204758
Product name
Anti-TMEM150A
Provider product page
Atlas Antibodies - HPA019015
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VMNHHVCPVENWSYNESCPPDPAEQGGPKTCCTLD
DVPLISKCGSYP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -