Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502652 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Nuclear Receptor Subfamily 2, Group C, Member 2 (NR2C2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NR2C2 antibody: synthetic peptide directed towards the N terminal of human NR2C2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
INKHHRNRCQFCRLKKCLEMGMKMESVQSERKPFD
VQREK PSNCAASTEK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
Bouwmeester T, Bauch A, Ruffner H, Angrand PO, Bergamini G, Croughton K, Cruciat C, Eberhard D, Gagneur J, Ghidelli S, Hopf C, Huhse B, Mangano R, Michon AM, Schirle M, Schlegl J, Schwab M, Stein MA, Bauer A, Casari G, Drewes G, Gavin AC, Jackson DB, Joberty G, Neubauer G, Rick J, Kuster B, Superti-Furga G
Nature cell biology 2004 Feb;6(2):97-105
Nature cell biology 2004 Feb;6(2):97-105
No comments: Submit comment
No validations: Submit validation data