HPA006313

NR2C2 antibody from Sigma-Aldrich
hTAK1, TAK1, TR2R1, TR4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006313
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006313, RRID:AB_1079503
Product name
Anti-NR2C2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006313
Antibody type
Polyclonal
Antigen
Orphan nuclear receptor TR4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DGARQTGLLDPGMLVNIQQPLIREDGTVLLATDSK
AETSQGALGTLANVVTSLANLSESLNNGDTSEIQP
EDQSASEITRAFDTLAKALNTTDSSSSPSLADGID
TSGGGSIHVISRDQSTPIIEVEGPLLSDTHVTFKL
TMPSPMP
Storage
-20C
Provider Type Product Number
- No reagents -