HPA022875

COASY antibody from Atlas Antibodies
CoASY, DPCK, NBP, PPAT
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022875
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022875, RRID:AB_1847066
Product name
Anti-COASY
Provider product page
Atlas Antibodies - HPA022875
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RVFGNKKQLKILTDIMWPIIAKLAREEMDRAVAEG
KRVCVIDAAVLLEAGWQNLVHEVWTAVIPETEAVR
RIVERDGLSEAAAQSRLQSQMSGQQLVEQSHVVLS
TLWEPHITQRQVEKAWALLQKRIPKTHQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -