HPA023273

COASY antibody from Sigma-Aldrich
CoASY, DPCK, NBP, PPAT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023273
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023273, RRID:AB_1847068
Product name
Anti-COASY antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023273
Antibody type
Polyclonal
Antigen
Bifunctional coenzyme A synthase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ENDLEELALYQIQLLKDLRHTENEEDKVSSSSFRQ
RMLGNLLRPPYERPELPTCLYVIGLTGISGSGKSS
IAQRLKGLGAFVIDSDHLGHRAYAPGGPAYQPVVE
AFGTDILHKDGIINRKV
Storage
-20C
Provider Type Product Number
- No reagents -