HPA034823

USP39 antibody from MilliporeSigma / Merck KGaA
CGI-21, SAD1, SNRNP65
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA034823
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA034823, RRID:AB_10602488
Product name
Anti-USP39 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA034823
Antibody type
Polyclonal
Antigen
ubiquitin specific peptidase 39 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANI
VHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDIL
PQMITLSEAYIQIWKRRDNDETN
Storage
-20C
Provider Type Product Number
- No reagents -