HPA021403

LRSAM1 antibody from Atlas Antibodies
CMT2P, FLJ31641
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021403
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021403, RRID:AB_1853366
Product name
Anti-LRSAM1
Provider product page
Atlas Antibodies - HPA021403
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LENERIRMEQLMSITQEETESLRRRDVASAMQQML
TESCKNRLIQMAYESQRQNLVQQACSSMAEMDERF
QQILSWQQMDQNKAISQI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -