HPA021844

LRSAM1 antibody from Sigma-Aldrich
CMT2P, FLJ31641
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021844
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021844, RRID:AB_1853368
Product name
Anti-LRSAM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021844
Antibody type
Polyclonal
Antigen
E3 ubiquitin-protein ligase LRSAM1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
REILTELEAKSETRQENYWLIQYQRLLNQKPLSLK
LQEEGMERQLVALLEELSAEHYLPIFAHHRLSLDL
LSQMSPGDLAKVGVSEAGLQHEILR
Storage
-20C
Provider Type Product Number
- No reagents -