HPA008393

RORB antibody from Sigma-Aldrich
NR1F2, ROR-BETA, RZRB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008393
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008393, RRID:AB_1079830
Product name
Anti-RORB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008393
Antibody type
Polyclonal
Antigen
Nuclear receptor ROR-beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QRDSLYAEVQKHQQRLQEQRQQQSGEAEALARVYS
SSISNGLSNLNNETSGTYANGHVIDLPKSEGYYNV
DSGQPSPDQSGLDMTGIKQIKQEPIYDLTSVPNLF
TYSSFNNGQLAPGITMTEIDRIAQNIIKSHLE
Storage
-20C
Provider Type Product Number
- No reagents -