HPA001426

LGMN antibody from Sigma-Aldrich
LGMN1, PRSC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001426
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001426, RRID:AB_1079247
Product name
Anti-LGMN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001426
Antibody type
Polyclonal
Antigen
Legumain precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QGMKRKASSPVPLPPVTHLDLTPSPDVPLTIMKRK
LMNTNDLEESRQLTEEIQRHLDARHLIEKSVRKIV
SLLAASEAEVEQLLSERAPLTGHSCYPEALLHFRT
HCFNWHSPTYEYALRHLYVLVNLCEKPYPLHRIKL
SMDHVCLGHY
Storage
-20C
Provider Type Product Number
- No reagents -