HPA018900

ERGIC1 antibody from Sigma-Aldrich
ERGIC-32, ERGIC32, KIAA1181, NET24
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018900
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018900, RRID:AB_1848242
Product name
Anti-ERGIC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018900
Antibody type
Polyclonal
Antigen
Endoplasmic reticulum-Golgi intermediate compartment protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PGNFHVSTHSATAQPQNPDMTHVIHKLSFGDTLQV
QNIHGAFNALGGADRLTSNPLASHDYIL
Storage
-20C
Provider Type Product Number
- No reagents -