HPA018666

ERGIC1 antibody from Atlas Antibodies
ERGIC-32, ERGIC32, KIAA1181, NET24
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018666
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018666, RRID:AB_1848241
Product name
Anti-ERGIC1
Provider product page
Atlas Antibodies - HPA018666
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VVNELYVDDPDKDSGGKIDVSLNISLPNLHCELVG
LDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQF
SINK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -